Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPHP4 Rabbit pAb (APR28465N)

Product Specifications

Background

This gene encodes a protein involved in renal tubular development and function. This protein interacts with nephrocystin, and belongs to a multifunctional complex that is localized to actin- and microtubule-based structures. Mutations in this gene are associated with nephronophthisis type 4, a renal disease, and with Senior-Loken syndrome type 4, a combination of nephronophthisis and retinitis pigmentosa. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NPHP4 Rabbit pAb (APR28465N) .

Synonyms

NPHP4; POC10; SLSN4

Gene ID

261734

UniProt

O75161

Cellular Locus

Cell junction, Cytoplasm, centrosome, cilium basal body, cytoskeleton, microtubule organizing center, tight junction

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 99kDa/157kDa Observed MW: 157kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=261734

Uniprot URL

https://www.uniprot.org/uniprot/O75161

AA Sequence

RLSLVLRGTQTVRKVRAFTSHPQELKTDPKGVFVLPPRGVQDLHVGVRPLRAGSRFVHLNLVDVDCHQLVASWLVCLCCRQPLISKAFEIMLAAGEGKGVNKRITYTNPYPSRRTFHLHSDHPELLRFREDSFQVGGGETYTIGLQFAPSQRVGEEEILIYINDHEDKNEEAFCVKVIYQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti Chicken IgG (biotin)
43C-CB0326 1.5 mg

Rabbit anti Chicken IgG (biotin)

Sign In for Pricing
View Details
Goat CD9 antigen (CD9) ELISA kit
GTR10414571 96 Well

Goat CD9 antigen (CD9) ELISA kit

Sign In for Pricing
View Details
Lentiviral mouse Slc15a1 shRNA (UAS) - Lentiviral mouse Slc15a1 shRNA (UAS, iRFP) (100)
GTR15213699 1 Vial

Lentiviral mouse Slc15a1 shRNA (UAS) - Lentiviral mouse Slc15a1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
AHSP (Alpha-hemoglobin-stabilizing Protein, EDRF, ERAF, Erythroid Associated Factor, Erythroid Differentiation-related Factor) (MaxLight 650)
123100-ML650 100 µL

AHSP (Alpha-hemoglobin-stabilizing Protein, EDRF, ERAF, Erythroid Associated Factor, Erythroid Differentiation-related Factor) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Tumor Necrosis Factor Alpha (TNFa)
MBS2031743-01 0.01 mg

Recombinant Tumor Necrosis Factor Alpha (TNFa)

Sign In for Pricing
View Details
Recombinant Tumor Necrosis Factor Alpha (TNFa)
MBS2031743-02 0.05 mg

Recombinant Tumor Necrosis Factor Alpha (TNFa)

Sign In for Pricing
View Details