Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP133 Rabbit pAb (APR28447N)

Product Specifications

Background

The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. The nucleoporin protein encoded by this gene displays evolutionarily conserved interactions with other nucleoporins. This protein, which localizes to both sides of the nuclear pore complex at interphase, remains associated with the complex during mitosis and is targeted at early stages to the reforming nuclear envelope. This protein also localizes to kinetochores of mitotic cells.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NUP133 Rabbit pAb (APR28447N) .

Synonyms

NUP133; hNUP133

Gene ID

55746

UniProt

Q8WUM0

Cellular Locus

Chromosome, Nucleus, centromere, kinetochore, nuclear pore complex

Applications

WB (Homo sapiens)

Dilution

WB 1:1000 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 128kDa Observed MW: 133kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55746

Uniprot URL

https://www.uniprot.org/uniprot/Q8WUM0

AA Sequence

NILKDMLQAASHYRQNRNSLYRREESLEKEPEYVPWTATSGPGGIRTVIIRQHEIVLKVAYPQADSNLRNIVTEQLVALIDCFLDGYVSQLKSVDKSSNRERYDNLEMEYLQKRSDLLSPLLSLGQYLWAASLAEKYCDFDILVQMCEQTDNQSRLQRYMTQFADQNFSDFLFRWYLEKGKRGKLLSQPISQHGQLANFLQ

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NEK4 (Never in Mitosis A-related Kinase 4, NimA-related Protein Kinase 4, NRK2, pp12301, Serine/threonine Protein Kinase 2, STK2, Serine/threonine Protein Kinase Nek4, Serine/threonine Protein Kinase NRK2, MGC33171) (MaxLight 405)
MBS6191402-01 0.1 mL

NEK4 (Never in Mitosis A-related Kinase 4, NimA-related Protein Kinase 4, NRK2, pp12301, Serine/threonine Protein Kinase 2, STK2, Serine/threonine Protein Kinase Nek4, Serine/threonine Protein Kinase NRK2, MGC33171) (MaxLight 405)

Ask
View Details
NEK4 (Never in Mitosis A-related Kinase 4, NimA-related Protein Kinase 4, NRK2, pp12301, Serine/threonine Protein Kinase 2, STK2, Serine/threonine Protein Kinase Nek4, Serine/threonine Protein Kinase NRK2, MGC33171) (MaxLight 405)
MBS6191402-02 5x 0.1 mL

NEK4 (Never in Mitosis A-related Kinase 4, NimA-related Protein Kinase 4, NRK2, pp12301, Serine/threonine Protein Kinase 2, STK2, Serine/threonine Protein Kinase Nek4, Serine/threonine Protein Kinase NRK2, MGC33171) (MaxLight 405)

Ask
View Details
Human GADD45B activation kit by CRISPRa
GA103059 1 Kit

Human GADD45B activation kit by CRISPRa

Ask
View Details
Il2ra Rat Monoclonal Antibody [Clone ID: 3C7]
AM08036PU-N 500 µg

Il2ra Rat Monoclonal Antibody [Clone ID: 3C7]

Ask
View Details
Fgf12 (NM_010199) Mouse Untagged Clone
MC207274 10 µg

Fgf12 (NM_010199) Mouse Untagged Clone

Ask
View Details
Human Embigin homolog (EMB) activation kit by CRISPRa
GA115198 1 Kit

Human Embigin homolog (EMB) activation kit by CRISPRa

Ask
View Details