Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2F3 Rabbit pAb (APR28443N)

Product Specifications

Background

This gene encodes a member of a small family of transcription factors that function through binding of DP interaction partner proteins. The encoded protein recognizes a specific sequence motif in DNA and interacts directly with the retinoblastoma protein (pRB) to regulate the expression of genes involved in the cell cycle. Altered copy number and activity of this gene have been observed in a number of human cancers. There are pseudogenes for this gene on chromosomes 2 and 17. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality E2F3 Rabbit pAb (APR28443N) .

Synonyms

E2F3; E2F-3

Gene ID

1871

UniProt

O00716

Cellular Locus

Nucleus

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa/49kDa Observed MW: 53kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1871

Uniprot URL

https://www.uniprot.org/uniprot/O00716

AA Sequence

SIESLQIHLASTQGPIEVYLCPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-BTK (Rabbit, Monoclonal)
A109617 100 µL

Anti-BTK (Rabbit, Monoclonal)

Sign In for Pricing
View Details
OPHN1P1 Protein Lysate (Human) with C-Ha Tag
34843031 100 µg

OPHN1P1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Atp2b2 (NM_001036684) Mouse Tagged ORF Clone Lentiviral Particle
MR223661L4V 200 µL

Atp2b2 (NM_001036684) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
M2912
E1069-25mg 25 mg

M2912

Sign In for Pricing
View Details
Myelin Protein Zero (Myelin Protein P0, MPZ, P0, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, DSS, HMSNIB, Myelin Peripheral Protein, MPP) (MaxLight 550)
MBS6212656-01 0.1 mL

Myelin Protein Zero (Myelin Protein P0, MPZ, P0, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, DSS, HMSNIB, Myelin Peripheral Protein, MPP) (MaxLight 550)

Sign In for Pricing
View Details
Myelin Protein Zero (Myelin Protein P0, MPZ, P0, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, DSS, HMSNIB, Myelin Peripheral Protein, MPP) (MaxLight 550)
MBS6212656-02 5x 0.1 mL

Myelin Protein Zero (Myelin Protein P0, MPZ, P0, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, DSS, HMSNIB, Myelin Peripheral Protein, MPP) (MaxLight 550)

Sign In for Pricing
View Details