Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP36L1 Rabbit pAb (APR28442N)

Product Specifications

Background

This gene is a member of the TIS11 family of early response genes, which are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. This gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZFP36L1 Rabbit pAb (APR28442N) .

Synonyms

ZFP36L1; BRF1; Berg36; ERF-1; ERF1; RNF162B; TIS11B; cMG1

Gene ID

677

UniProt

Q07352

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa Observed MW: 45-50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=677

Uniprot URL

https://www.uniprot.org/uniprot/Q07352

AA Sequence

MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL27 Rabbit Monoclonal Antibody
E56G0799 100 µL

CCL27 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal HABP1/C1QBP/GC1q R Antibody [PerCP]
NBP2-98236PCP 0.1 mL

Rabbit Polyclonal HABP1/C1QBP/GC1q R Antibody [PerCP]

Sign In for Pricing
View Details
Mouse mmu-miR-6977-3p miRNA Agomir
abx884011-01 5 nmol

Mouse mmu-miR-6977-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-6977-3p miRNA Agomir
abx884011-02 10 nmol

Mouse mmu-miR-6977-3p miRNA Agomir

Sign In for Pricing
View Details
Mpc1 Mouse qPCR Template Standard (NM_018819)
MK201362 1 Kit

Mpc1 Mouse qPCR Template Standard (NM_018819)

Sign In for Pricing
View Details
Recombinant Pelodictyon luteolum Tryptophan synthase alpha chain (trpA)
MBS1356405-01 0.02 mg (E-Coli)

Recombinant Pelodictyon luteolum Tryptophan synthase alpha chain (trpA)

Sign In for Pricing
View Details