Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FNTA Rabbit pAb (APR28441N)

Product Specifications

Background

Prenyltransferases can attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of proteins with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 11 and 13.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FNTA Rabbit pAb (APR28441N) .

Synonyms

FNTA; FPTA; PGGT1A; PTAR2; farnesyltransferase; CAAX box; alpha

Gene ID

2339

UniProt

P49354

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa/44kDa Observed MW: 44kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2339

Uniprot URL

https://www.uniprot.org/uniprot/P49354

AA Sequence

LKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RBM14-RBM4 activation kit by CRISPRa
GA119337 1 Kit

Human RBM14-RBM4 activation kit by CRISPRa

Sign In for Pricing
View Details
Arl6ip5 (NM_022992) Mouse Tagged ORF Clone
MG201781 10 µg

Arl6ip5 (NM_022992) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2476), Biotin conjugate, 0.1mg/mL
BNCB2476-500 1x 500 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2476), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
POP1 (NM_001145861) Human Over-expression Lysate
LC429038 20 µg

POP1 (NM_001145861) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Ileum
CS626810 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
FOXG1 Rabbit Polyclonal Antibody
TA367454 100 µL

FOXG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details