Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FNTA Rabbit pAb (APR28441N)

Product Specifications

Background

Prenyltransferases can attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of proteins with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 11 and 13.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FNTA Rabbit pAb (APR28441N) .

Synonyms

FNTA; FPTA; PGGT1A; PTAR2; farnesyltransferase; CAAX box; alpha

Gene ID

2339

UniProt

P49354

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa/44kDa Observed MW: 44kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2339

Uniprot URL

https://www.uniprot.org/uniprot/P49354

AA Sequence

LKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LAP (TGF-beta 1) MAb (Clone 27232)
MAB2463-SP 25 µg

Human LAP (TGF-beta 1) MAb (Clone 27232)

Sign In for Pricing
View Details
Histone H4 (Mono Methyl Arg3) Polyclonal Antibody
orb399616-01 50 μL

Histone H4 (Mono Methyl Arg3) Polyclonal Antibody

Sign In for Pricing
View Details
Histone H4 (Mono Methyl Arg3) Polyclonal Antibody
orb399616-02 100 µL

Histone H4 (Mono Methyl Arg3) Polyclonal Antibody

Sign In for Pricing
View Details
6b-Hydroxy-21-desacetyl Deflazacort
MBS3841111-01 0.5 mg

6b-Hydroxy-21-desacetyl Deflazacort

Sign In for Pricing
View Details
6b-Hydroxy-21-desacetyl Deflazacort
MBS3841111-02 1 mg

6b-Hydroxy-21-desacetyl Deflazacort

Sign In for Pricing
View Details
6b-Hydroxy-21-desacetyl Deflazacort
MBS3841111-03 5x 1 mg

6b-Hydroxy-21-desacetyl Deflazacort

Sign In for Pricing
View Details