Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAX1BP3 Rabbit pAb (APR28428N)

Product Specifications

Background

This gene encodes a small, highly conserved protein with a single PDZ domain. PDZ (PSD-95/Discs large/ZO-1 homologous) domains promote protein-protein interactions that affect cell signaling, adhesion, protein scaffolding, and receptor and ion transporter functions. The encoded protein interacts with a large number of target proteins that play roles in signaling pathways; for example, it interacts with Rho A and glutaminase L and also acts as a negative regulator of the Wnt/beta-catenin signaling pathway. This protein was first identified as binding to the T-cell leukaemia virus (HTLV1) Tax oncoprotein. Overexpression of this gene has been implicated in altered cancer cell adhesion, migration and metastasis. The encoded protein also modulates the localization and density of inwardly rectifying potassium channel 2.3 (Kir2.3) . To date, this protein has been shown to play a role in cell proliferation, development, stress response, and polarization. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TAX1BP3 Rabbit pAb (APR28428N) .

Synonyms

TAX1BP3; TIP-1; TIP1

Gene ID

30851

UniProt

O14907

Cellular Locus

Cell membrane, Cytoplasm, Cytoplasmic side, Nucleus, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=30851

Uniprot URL

https://www.uniprot.org/uniprot/O14907

AA Sequence

MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pax8 shRNA (UAS) - Lentiviral mousePax8 shRNA (UAS, GFP) (25)
GTR15273428 1 Vial

Lentiviral mouse Pax8 shRNA (UAS) - Lentiviral mousePax8 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 23 (FGF23) ELISA Kit
MBS459292-01 48 Tests

Rat Fibroblast Growth Factor 23 (FGF23) ELISA Kit

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 23 (FGF23) ELISA Kit
MBS459292-02 96 Tests

Rat Fibroblast Growth Factor 23 (FGF23) ELISA Kit

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 23 (FGF23) ELISA Kit
MBS459292-03 5x 96 Tests

Rat Fibroblast Growth Factor 23 (FGF23) ELISA Kit

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 23 (FGF23) ELISA Kit
MBS459292-04 10x 96 Tests

Rat Fibroblast Growth Factor 23 (FGF23) ELISA Kit

Sign In for Pricing
View Details
SPAG16 sgRNA CRISPR Lentivector (Human) (Target 2)
K2265003 1.0 µg DNA

SPAG16 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details