Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC1 Rabbit pAb (APR28427N)

Product Specifications

Background

The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of the exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EXOC1 Rabbit pAb (APR28427N) .

Synonyms

EXOC1; BM-102; SEC3; SEC3L1; SEC3P

Gene ID

55763

UniProt

Q9NV70

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 100kDa/101kDa Observed MW: 102kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55763

Uniprot URL

https://www.uniprot.org/uniprot/Q9NV70

AA Sequence

RNFDKCISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFHHIFATLSRLKISCLEAEKKEAKQKYTDHLQSYVIYSLGQPLEKLNHFFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEENLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- ((4-Nitrophenyl) sulfonyl) piperazine
OR1038409-01 1 g

1- ((4-Nitrophenyl) sulfonyl) piperazine

Sign In for Pricing
View Details
1- ((4-Nitrophenyl) sulfonyl) piperazine
OR1038409-02 5 g

1- ((4-Nitrophenyl) sulfonyl) piperazine

Sign In for Pricing
View Details
MMP25 Antibody
orb1257977 100 µL

MMP25 Antibody

Sign In for Pricing
View Details
Cow Thrombopoietin (THPO) ELISA Kit
abx150202-01 96 Tests

Cow Thrombopoietin (THPO) ELISA Kit

Sign In for Pricing
View Details
Cow Thrombopoietin (THPO) ELISA Kit
abx150202-02 5x 96 Tests

Cow Thrombopoietin (THPO) ELISA Kit

Sign In for Pricing
View Details
Cow Thrombopoietin (THPO) ELISA Kit
abx150202-03 10x 96 Tests

Cow Thrombopoietin (THPO) ELISA Kit

Sign In for Pricing
View Details