Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FERMT2 Rabbit pAb (APR28410N)

Product Specifications

Background

Scaffolding protein that enhances integrin activation mediated by TLN1 and/or TLN2, but activates integrins only weakly by itself. Binds to membranes enriched in phosphoinositides. Enhances integrin-mediated cell adhesion onto the extracellular matrix and cell spreading; this requires both its ability to interact with integrins and with phospholipid membranes. Required for the assembly of focal adhesions. Participates in the connection between extracellular matrix adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. Recruits FBLIM1 to focal adhesions. Plays a role in the TGFB1 and integrin signaling pathways. Stabilizes active CTNNB1 and plays a role in the regulation of transcription mediated by CTNNB1 and TCF7L2/TCF4 and in Wnt signaling.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FERMT2 Rabbit pAb (APR28410N) .

Synonyms

FERMT2; KIND2; MIG2; PLEKHC1; UNC112; UNC112B; mig-2

Gene ID

10979

UniProt

Q96AC1

Cellular Locus

Cell junction, Cell projection, Cell surface, Cytoplasm, Cytoplasmic side, I band, Membrane, Nucleus, Peripheral membrane protein, cell cortex, cytoskeleton, focal adhesion, lamellipodium membrane, myofibril, sarcomere

Dilution

WB 1:1000 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 72kDa/77kDa/78kDa Observed MW: 78kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10979

Uniprot URL

https://www.uniprot.org/uniprot/Q96AC1

AA Sequence

KVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMS

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cy5 HA (MW 50000)
HY-D2643 1 Each

Cy5 HA (MW 50000)

Ask
View Details
LACE1, NT (LACE1, AFG1, Lactation elevated protein 1, Protein AFG1 homolog) (MaxLight 650)
MBS6315038-01 0.1 mL

LACE1, NT (LACE1, AFG1, Lactation elevated protein 1, Protein AFG1 homolog) (MaxLight 650)

Ask
View Details
LACE1, NT (LACE1, AFG1, Lactation elevated protein 1, Protein AFG1 homolog) (MaxLight 650)
MBS6315038-02 5x 0.1 mL

LACE1, NT (LACE1, AFG1, Lactation elevated protein 1, Protein AFG1 homolog) (MaxLight 650)

Ask
View Details
CGGBP1 (CGG Triplet Repeat-binding Protein 1, CGG-binding Protein 1, 20kD CGG-binding Protein, p20-CGGBP DNA-binding Protein, CGGBP) (MaxLight 650)
MBS6221450-01 0.1 mL

CGGBP1 (CGG Triplet Repeat-binding Protein 1, CGG-binding Protein 1, 20kD CGG-binding Protein, p20-CGGBP DNA-binding Protein, CGGBP) (MaxLight 650)

Ask
View Details
CGGBP1 (CGG Triplet Repeat-binding Protein 1, CGG-binding Protein 1, 20kD CGG-binding Protein, p20-CGGBP DNA-binding Protein, CGGBP) (MaxLight 650)
MBS6221450-02 5x 0.1 mL

CGGBP1 (CGG Triplet Repeat-binding Protein 1, CGG-binding Protein 1, 20kD CGG-binding Protein, p20-CGGBP DNA-binding Protein, CGGBP) (MaxLight 650)

Ask
View Details
Rabbit Anti-Glucosidase IIβ/PRKCSH Polyclonal Antibody
PAV7574 100 μL

Rabbit Anti-Glucosidase IIβ/PRKCSH Polyclonal Antibody

Ask
View Details