Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHL3 Rabbit pAb (APR28405N)

Product Specifications

Background

The protein encoded by this gene is a member of a family of proteins containing a four-and-a-half LIM domain, which is a highly conserved double zinc finger motif. The encoded protein has been shown to interact with the cancer developmental regulators SMAD2, SMAD3, and SMAD4, the skeletal muscle myogenesis protein MyoD, and the high-affinity IgE beta chain regulator MZF-1. This protein may be involved in tumor suppression, repression of MyoD expression, and repression of IgE receptor expression. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FHL3 Rabbit pAb (APR28405N) .

Synonyms

FHL3; SLIM2

Gene ID

2275

UniProt

Q13643

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa Observed MW: 31-36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2275

Uniprot URL

https://www.uniprot.org/uniprot/Q13643

AA Sequence

MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-PCNA Recombinant Monoclonal Antibody [BLR075G]
MBS3906332-01 0.1 mg

Rabbit anti-PCNA Recombinant Monoclonal Antibody [BLR075G]

Sign In for Pricing
View Details
Rabbit anti-PCNA Recombinant Monoclonal Antibody [BLR075G]
MBS3906332-02 5x 0.1 mg

Rabbit anti-PCNA Recombinant Monoclonal Antibody [BLR075G]

Sign In for Pricing
View Details
GDPD1 (NM_182569) Human Over-expression Lysate
LH15899V 100 µg

GDPD1 (NM_182569) Human Over-expression Lysate

Sign In for Pricing
View Details
Nasopharyngeal carcinoma down-regulated gene protein 1 (NPCDR1) Human ELISA Kit
F2824 96 Tests

Nasopharyngeal carcinoma down-regulated gene protein 1 (NPCDR1) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Mycobacterium vanbaalenii Isopentenyl-diphosphate delta-isomerase (fni)
MBS1009392-01 0.02 mg (E-Coli)

Recombinant Mycobacterium vanbaalenii Isopentenyl-diphosphate delta-isomerase (fni)

Sign In for Pricing
View Details
Recombinant Mycobacterium vanbaalenii Isopentenyl-diphosphate delta-isomerase (fni)
MBS1009392-02 0.02 mg (Yeast)

Recombinant Mycobacterium vanbaalenii Isopentenyl-diphosphate delta-isomerase (fni)

Sign In for Pricing
View Details