Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Septin 9 Rabbit pAb (APR28400N)

Product Specifications

Background

This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Septin 9 Rabbit pAb (APR28400N) .

Synonyms

SEPT9; AF17q25; MSF; MSF1; NAPB; PNUTL4; SINT1; SeptD1; septin-9

Gene ID

10801

UniProt

Q9UHD8

Cellular Locus

Cytoplasm, cytoskeleton

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 38kDa/41kDa/47kDa/52kDa/63kDa/64kDa/65kDa Observed MW: 75kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10801

Uniprot URL

https://www.uniprot.org/uniprot/Q9UHD8

AA Sequence

MEPPASKVPEVPTAPATDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CTCF Antibody
RC-15543-01 50 μL

Recombinant CTCF Antibody

Sign In for Pricing
View Details
Recombinant CTCF Antibody
RC-15543-02 100 µL

Recombinant CTCF Antibody

Sign In for Pricing
View Details
Recombinant CTCF Antibody
RC-15543-03 1 mL

Recombinant CTCF Antibody

Sign In for Pricing
View Details
IPO-38 (IPO-38), 1mg/mL
BNUM0697-50 1x 50 µL

IPO-38 (IPO-38), 1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CGA414 + CGA/777 + CGA/798), CF405S conjugate, 0.1mg/mL
BNC041060-100 1x 100 µL

Chromogranin A (CGA414 + CGA/777 + CGA/798), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FISH (SH3PXD2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F5]
TA811757AM 100 µL

FISH (SH3PXD2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F5]

Sign In for Pricing
View Details