Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KPNB1 Rabbit pAb (APR28383N)

Product Specifications

Background

Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family. Two transcript variants encoding different isoforms have been found for this gene.

Synonyms

KPNB1; IMB1; IPO1; IPOB; Impnb; NTF97

Gene ID

3837

UniProt

Q14974

Cellular Locus

Cytoplasm, Nucleus envelope

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 81kDa/97kDa Observed MW: 97KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KPNB1 Rabbit pAb (APR28383N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3837

Uniprot URL

https://www.uniprot.org/uniprot/Q14974

AA Sequence

QYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEAAEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Gm6238 Mouse siRNA Oligo Duplex (Locus ID 621542)
SR403297 1 Kit

Gm6238 Mouse siRNA Oligo Duplex (Locus ID 621542)

Ask
View Details
Mouse Complement Receptor 2 (CR2) Antibody Pair Kit (with Standard)
MBS2099393-01 5x 96 Tests

Mouse Complement Receptor 2 (CR2) Antibody Pair Kit (with Standard)

Ask
View Details
Mouse Complement Receptor 2 (CR2) Antibody Pair Kit (with Standard)
MBS2099393-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Complement Receptor 2 (CR2) Antibody Pair Kit (with Standard)

Ask
View Details
Mouse Complement Receptor 2 (CR2) Antibody Pair Kit (with Standard)
MBS2099393-03 10x 96 Tests

Mouse Complement Receptor 2 (CR2) Antibody Pair Kit (with Standard)

Ask
View Details
Mouse Complement Receptor 2 (CR2) Antibody Pair Kit (with Standard)
MBS2099393-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Complement Receptor 2 (CR2) Antibody Pair Kit (with Standard)

Ask
View Details
PIC 482 RL-TRI 025-B7541 AC Signs
227352 Roll of 250 Pictogram(s)

PIC 482 RL-TRI 025-B7541 AC Signs

Ask
View Details