Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS11A Rabbit pAb (APR28379N)

Product Specifications

Background

Probable serine protease which may play a role in cellular senescence. Overexpression inhibits cell growth and induce G1 cell cycle arrest.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TMPRSS11A Rabbit pAb (APR28379N) .

Synonyms

TMPRSS11A; ECRG1

Gene ID

339967

UniProt

Q6ZMR5

Cellular Locus

Membrane, Single-pass type II membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 47kDa Observed MW: 48kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=339967

Uniprot URL

https://www.uniprot.org/uniprot/Q6ZMR5

AA Sequence

SASFQPNLTVHITGFGALYYGGESQNDLREARVKIISDDVCKQPQVYGNDIKPGMFCAGYMEGIYDACRGDSGGPLVTRDLKDTWYLIGIVSWGDNCGQKDKPGVYTQVTYYRNWIASKTGI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPT7 Rabbit Monoclonal Antibody
E56G0711 100 µL

SEPT7 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-DNA Antibody (MRL-22)
RGK23902 100 μg

Anti-DNA Antibody (MRL-22)

Sign In for Pricing
View Details
SPRYD3 Human shRNA Plasmid Kit (Locus ID 84926)
TR301401 1 Kit

SPRYD3 Human shRNA Plasmid Kit (Locus ID 84926)

Sign In for Pricing
View Details
PFKFB3 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3, 6PF-2-K/Fru-2,6-P2ase 3, PFK/FBPase 3, 6PF-2-K/Fru-2,6-P2ase Brain/placenta-type Isozyme, FLJ37326, IPFK2, iPFK-2, PFK2, Renal Carcinoma Antigen NY-REN-56) (MaxLight 490)
MBS6389125-01 0.1 mL

PFKFB3 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3, 6PF-2-K/Fru-2,6-P2ase 3, PFK/FBPase 3, 6PF-2-K/Fru-2,6-P2ase Brain/placenta-type Isozyme, FLJ37326, IPFK2, iPFK-2, PFK2, Renal Carcinoma Antigen NY-REN-56) (MaxLight 490)

Sign In for Pricing
View Details
PFKFB3 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3, 6PF-2-K/Fru-2,6-P2ase 3, PFK/FBPase 3, 6PF-2-K/Fru-2,6-P2ase Brain/placenta-type Isozyme, FLJ37326, IPFK2, iPFK-2, PFK2, Renal Carcinoma Antigen NY-REN-56) (MaxLight 490)
MBS6389125-02 5x 0.1 mL

PFKFB3 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3, 6PF-2-K/Fru-2,6-P2ase 3, PFK/FBPase 3, 6PF-2-K/Fru-2,6-P2ase Brain/placenta-type Isozyme, FLJ37326, IPFK2, iPFK-2, PFK2, Renal Carcinoma Antigen NY-REN-56) (MaxLight 490)

Sign In for Pricing
View Details
GSTM5 (Glutathione S-Transferase mu 5, GSTM5-5, GTM5) (MaxLight 650)
MBS6227859-01 0.1 mL

GSTM5 (Glutathione S-Transferase mu 5, GSTM5-5, GTM5) (MaxLight 650)

Sign In for Pricing
View Details