Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO2 Rabbit pAb (APR28357N)

Product Specifications

Background

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. This protein is highly similar to the rat NFB42 (neural F Box 42 kDa) protein which is enriched in the nervous system and may play a role in maintaining neurons in a postmitotic state.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FBXO2 Rabbit pAb (APR28357N) .

Synonyms

FBXO2; FBG1; FBX2; Fbs1; NFB42; OCP1

Gene ID

26232

UniProt

Q9UK22

Cellular Locus

Cytoplasm, Cytoplasmic side, Microsome membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 33kDa Observed MW: 39kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26232

Uniprot URL

https://www.uniprot.org/uniprot/Q9UK22

AA Sequence

MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JUP Antibody
orb1178266 100 µg

JUP Antibody

Sign In for Pricing
View Details
Chicken Collagen Alpha 2 (VI) chain (COL6A2) ELISA Kit
GTR10324132 96 Well

Chicken Collagen Alpha 2 (VI) chain (COL6A2) ELISA Kit

Sign In for Pricing
View Details
Hoxa11 sgRNA CRISPR Lentivector set (Mouse)
K4396601 3x 1.0 µg

Hoxa11 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
MLH1 Rabbit Polyclonal Antibody (FITC)
orb2597248 100 µg

MLH1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
DBX1 Human Gene Knockout Kit (CRISPR)
KN424662 1 Kit

DBX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Growth Differentiation Factor 6 (GDF6) Antibody
abx103265-01 100 µL

Growth Differentiation Factor 6 (GDF6) Antibody

Sign In for Pricing
View Details