Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG2A Rabbit pAb (APR28355N)

Product Specifications

Background

Lipid transfer protein involved in autophagosome assembly. Tethers the edge of the isolation membrane (IM to the endoplasmic reticulum (ER and mediates direct lipid transfer from ER to IM for IM expansion. Binds to the ER exit site (ERES, which is the membrane source for autophagosome formation, and extracts phospholipids from the membrane source and transfers them to ATG9 (ATG9A or ATG9B to the IM for membrane expansion. Lipid transfer activity is enhanced by WIPI1 and WDR45/WIPI4, which promote ATG2A-association with phosphatidylinositol 3-monophosphate (PI3P-containing membranes. Also regulates lipid droplets morphology and distribution within the cell.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ATG2A Rabbit pAb (APR28355N) .

Synonyms

ATG2A

Gene ID

23130

UniProt

Q2TAZ0

Cellular Locus

Lipid droplet, Peripheral membrane protein, Preautophagosomal structure membrane

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/35kDa/212kDa/213kDa Observed MW: 213kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23130

Uniprot URL

https://www.uniprot.org/uniprot/Q2TAZ0

AA Sequence

DLHGIYEDGGKPPVPCLRVSKALDPKSTGRKYFLPQVVVTVNPQSSSTQWEVAPEKGEELELSVESPCELREPEPSPFSSKRTMYETEEMVIPGDPEEMRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Interleukin-1 family member 10 ELISA Kit
MBS2888280-01 48 Well

Mouse Interleukin-1 family member 10 ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin-1 family member 10 ELISA Kit
MBS2888280-02 96 Well

Mouse Interleukin-1 family member 10 ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin-1 family member 10 ELISA Kit
MBS2888280-03 5x 96 Well

Mouse Interleukin-1 family member 10 ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin-1 family member 10 ELISA Kit
MBS2888280-04 10x 96 Well

Mouse Interleukin-1 family member 10 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Xkr8 shRNA (UAS) - Lentiviral mouseXkr8 shRNA (UAS, GFP) (25)
GTR15260396 1 Vial

Lentiviral mouse Xkr8 shRNA (UAS) - Lentiviral mouseXkr8 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Gibberellic acid
orb702082 50 mg

Gibberellic acid

Sign In for Pricing
View Details