Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] B4GALT1 Rabbit pAb (APR28327N)

Product Specifications

Background

This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. This gene is unique among the beta4GalT genes because it encodes an enzyme that participates both in glycoconjugate and lactose biosynthesis. For the first activity, the enzyme adds galactose to N-acetylglucosamine residues that are either monosaccharides or the nonreducing ends of glycoprotein carbohydrate chains. The second activity is restricted to lactating mammary tissues where the enzyme forms a heterodimer with alpha-lactalbumin to catalyze UDP-galactose + D-glucose <=> UDP + lactose. The two enzymatic forms result from alternate transcription initiation sites and post-translational processing. Two transcripts, which differ only at the 5' end, with approximate lengths of 4.1 kb and 3.9 kb encode the same protein. The longer transcript encodes the type II membrane-bound, trans-Golgi resident protein involved in glycoconjugate biosynthesis. The shorter transcript encodes a protein which is cleaved to form the soluble lactose synthase.

Synonyms

B4GALT1; B4GAL-T1; CDG2D; GGTB2; GT1; GTB; beta4Gal-T1; beta-1

Gene ID

2683

UniProt

P15291

Cellular Locus

Cell membrane, Cell projection, Cell surface, Golgi apparatus, Golgi stack membrane, Secreted, Single-pass type II membrane protein, filopodium

Applications

WB (Homo sapiens) IHC (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa/43kDa Observed MW: 55kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] B4GALT1 Rabbit pAb (APR28327N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2683

Uniprot URL

https://www.uniprot.org/uniprot/P15291

AA Sequence

LPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVIN

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-IPO9 Antibody Picoband® (Biotine Conjugate)
A10216-2-Biotin 100 μg

Anti-IPO9 Antibody Picoband® (Biotine Conjugate)

Ask
View Details
Mouse A Disintegrin And Metalloprotease 8 (ADAM8) ELISA Kit
CK-bio-15586-01 48 Tests

Mouse A Disintegrin And Metalloprotease 8 (ADAM8) ELISA Kit

Ask
View Details
Mouse A Disintegrin And Metalloprotease 8 (ADAM8) ELISA Kit
CK-bio-15586-02 96 Tests

Mouse A Disintegrin And Metalloprotease 8 (ADAM8) ELISA Kit

Ask
View Details
Mouse A Disintegrin And Metalloprotease 8 (ADAM8) ELISA Kit
CK-bio-15586-03 5x 96 Tests

Mouse A Disintegrin And Metalloprotease 8 (ADAM8) ELISA Kit

Ask
View Details
Mouse A Disintegrin And Metalloprotease 8 (ADAM8) ELISA Kit
CK-bio-15586-04 10x 96 Tests

Mouse A Disintegrin And Metalloprotease 8 (ADAM8) ELISA Kit

Ask
View Details
XFD350 Anti-human CD314 Antibody *1D11*
13140140-AAT 100 Tests

XFD350 Anti-human CD314 Antibody *1D11*

Ask
View Details