Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCGRT Rabbit pAb (APR28325N)

Product Specifications

Background

This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FCGRT Rabbit pAb (APR28325N) .

Synonyms

FCGRT; FCRN; alpha-chain

Gene ID

2217

UniProt

P55899

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2217

Uniprot URL

https://www.uniprot.org/uniprot/P55899

AA Sequence

ESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMO4 Polyclonal Antibody
MBS9244186-01 0.1 mL

LMO4 Polyclonal Antibody

Sign In for Pricing
View Details
LMO4 Polyclonal Antibody
MBS9244186-02 5x 0.1 mL

LMO4 Polyclonal Antibody

Sign In for Pricing
View Details
Growth Hormone, Human (hGH) BioAssayTM ELISA Kit
G9000-01 96 Tests

Growth Hormone, Human (hGH) BioAssayTM ELISA Kit

Sign In for Pricing
View Details
3-[ (3-Chlorobenzyl) oxy]pyrrolidine hydrochloride
sc-312062 500 mg

3-[ (3-Chlorobenzyl) oxy]pyrrolidine hydrochloride

Sign In for Pricing
View Details
P53 (Mono Methyl Lys370) Monoclonal Antibody, PE-Cy5.5 Conjugated
bsm-33209M-PE-Cy5.5 100 µL

P53 (Mono Methyl Lys370) Monoclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal MDMX Antibody (OTI4G5) [Biotin]
NBP2-72605B 0.1 mL

Mouse Monoclonal MDMX Antibody (OTI4G5) [Biotin]

Sign In for Pricing
View Details