Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCGRT Rabbit pAb (APR28325N)

Product Specifications

Background

This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FCGRT Rabbit pAb (APR28325N) .

Synonyms

FCGRT; FCRN; alpha-chain

Gene ID

2217

UniProt

P55899

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2217

Uniprot URL

https://www.uniprot.org/uniprot/P55899

AA Sequence

ESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-phospho-Cdc6 (Ser54) antibody
SL5246R-01 50 µL

Rabbit Anti-phospho-Cdc6 (Ser54) antibody

Sign In for Pricing
View Details
Rabbit Anti-phospho-Cdc6 (Ser54) antibody
SL5246R-02 100 µL

Rabbit Anti-phospho-Cdc6 (Ser54) antibody

Sign In for Pricing
View Details
ALDH1L1 Rabbit Monoclonal Antibody
E49Y8140 100 µL

ALDH1L1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
HMG20B cDNA Clone
MBS1273331-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

HMG20B cDNA Clone

Sign In for Pricing
View Details
HMG20B cDNA Clone
MBS1273331-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

HMG20B cDNA Clone

Sign In for Pricing
View Details
Zfp869 AAV Vector (Mouse) (CMV)
51162105 1 µg

Zfp869 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details