Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOX1 Rabbit pAb (APR28312N)

Product Specifications

Background

This gene encodes a member of the NADPH oxidase family of enzymes responsible for the catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NOX1 Rabbit pAb (APR28312N) .

Synonyms

NOX1; GP91-2; MOX1; NOH-1; NOH1

Gene ID

27035

UniProt

Q9Y5S8

Cellular Locus

Cell projection, Multi-pass membrane protein, invadopodium membrane

Applications

IHC (Mus musculus) WB (Homo sapiens, Rattus norvegicus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa/58kDa/64kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=27035

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y5S8

AA Sequence

KSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Z-L-glutamic acid γ-cyclohexyl ester dicyclohexylammonium salt
sc-479367A 5 g

Z-L-glutamic acid γ-cyclohexyl ester dicyclohexylammonium salt

Sign In for Pricing
View Details
Homeobox protein prophet of Pit-1 (PROP1) Human ELISA Kit
E1145 96 Tests

Homeobox protein prophet of Pit-1 (PROP1) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Fibrous sheath CABYR-binding protein (FSCB) , partial
MBS1387565 Inquire

Recombinant Human Fibrous sheath CABYR-binding protein (FSCB) , partial

Sign In for Pricing
View Details
PAR-3 (G-4) Alexa Fluor® 790
sc-393127 AF790 200 µg/mL

PAR-3 (G-4) Alexa Fluor® 790

Sign In for Pricing
View Details
POLYART CHARTS Crayfish–Feathery Jills
4060400/22 1 Each

POLYART CHARTS Crayfish–Feathery Jills

Sign In for Pricing
View Details
ARSI Antibody Blocking Peptide
orb1514059 500 µg

ARSI Antibody Blocking Peptide

Sign In for Pricing
View Details