Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RMI2 Rabbit pAb (APR28308N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RMI2 Rabbit pAb (APR28308N) .

Synonyms

RMI2; BLAP18; C16orf75

Gene ID

116028

UniProt

Q96E14

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 9kDa/15kDa Observed MW: 16kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=116028

Uniprot URL

https://www.uniprot.org/uniprot/Q96E14

AA Sequence

MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Amino-4-chloro-N- (propan-2-yl) benzamide
BMB22168 5 g

3-Amino-4-chloro-N- (propan-2-yl) benzamide

Sign In for Pricing
View Details
SLC27A2 (Solute Carrier Family 27 Member 2, ACSVL1, FACVL1, FATP2, HsT17226, VLACS, VLCS, hFACVL1) (MaxLight 405)
MBS6437930-01 0.1 mL

SLC27A2 (Solute Carrier Family 27 Member 2, ACSVL1, FACVL1, FATP2, HsT17226, VLACS, VLCS, hFACVL1) (MaxLight 405)

Sign In for Pricing
View Details
SLC27A2 (Solute Carrier Family 27 Member 2, ACSVL1, FACVL1, FATP2, HsT17226, VLACS, VLCS, hFACVL1) (MaxLight 405)
MBS6437930-02 5x 0.1 mL

SLC27A2 (Solute Carrier Family 27 Member 2, ACSVL1, FACVL1, FATP2, HsT17226, VLACS, VLCS, hFACVL1) (MaxLight 405)

Sign In for Pricing
View Details
Epstein Barr Virus (EBV), Viral Capsid Antigen, gp125 (APC)
E3440-28C-APC 100 µL

Epstein Barr Virus (EBV), Viral Capsid Antigen, gp125 (APC)

Sign In for Pricing
View Details
Mouse Atat1 (NM_001142744) AAV Particle
MR206707A1V 250 µL

Mouse Atat1 (NM_001142744) AAV Particle

Sign In for Pricing
View Details
Dectin 2 Rabbit Polyclonal Antibody
orb234821-01 30 µL

Dectin 2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details