Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DERL1 Rabbit pAb (APR28294N)

Product Specifications

Background

The protein encoded by this gene is a member of the derlin family. Members of this family participate in the ER-associated degradation response and retrotranslocate misfolded or unfolded proteins from the ER lumen to the cytosol for proteasomal degradation. This protein recognizes substrate in the ER and works in a complex to retrotranslocate it across the ER membrane into the cytosol. This protein may select cystic fibrosis transmembrane conductance regulator protein (CFTR) for degradation as well as unfolded proteins in Alzheimer's disease. Alternative splicing results in multiple transcript variants that encode different protein isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DERL1 Rabbit pAb (APR28294N) .

Synonyms

DERL1; DER-1; DER1; derlin-1

Gene ID

79139

UniProt

Q9BUN8

Cellular Locus

Endoplasmic reticulum membrane, Multi-pass membrane protein

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa/28kDa Observed MW: 29kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=79139

Uniprot URL

https://www.uniprot.org/uniprot/Q9BUN8

AA Sequence

LYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS645463 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus
CS804338 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details
QuantiChrom™ Formaldehyde Assay Kit
DFOR-100 100 Tests

QuantiChrom™ Formaldehyde Assay Kit

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD132 Antibody[3E12]
E-AB-F10150-01 100 µg

AF/LE Purified Anti-Mouse CD132 Antibody[3E12]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD132 Antibody[3E12]
E-AB-F10150-02 1 mg

AF/LE Purified Anti-Mouse CD132 Antibody[3E12]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD132 Antibody[3E12]
E-AB-F10150-03 5 mg

AF/LE Purified Anti-Mouse CD132 Antibody[3E12]

Sign In for Pricing
View Details