Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R4 Rabbit pAb (APR28291N)

Product Specifications

Background

The protein encoded by this gene is a HEAT-like repeat-containing protein. The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins. Arrays of HEAT repeats form a rod-like helical structure and appear to function as protein-protein interaction surfaces. The repeat-containing region of this protein has some similarity to the constant regulatory domain of the protein phosphatase 2A PR65/A subunit. The encoded protein binds protein serine/threonine phosphatase 4c in the cytoplasm.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PPP4R4 Rabbit pAb (APR28291N) .

Synonyms

PPP4R4; CFAP14; KIAA1622; PP4R4

Gene ID

57718

UniProt

Q6NUP7

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/99kDa Observed MW: 99kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57718

Uniprot URL

https://www.uniprot.org/uniprot/Q6NUP7

AA Sequence

NVRMKLCYLLPKVKSTLKIPADKHLLQQLEMCVRKLLCQEKDKDVLAIVKRTVLELDRMEMSMDAFQKKFYEKDLLDQEKEREELLLLEMEQLEKEKQQNDGRPMSDKMFEKKRRDTKTPTQSLPKNIPISVPGPSSVTPSTSKEIKKSKLIRSQSFNNQAFHAKYGNLEKCASKSSTTGYTTSVSGLGKTSVLSLADDSFRTRNASSVPS

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Genesig Real-Time PCR detection kit for Human Herpesvirus 8, Advanced
349137 1 Kit

Genesig Real-Time PCR detection kit for Human Herpesvirus 8, Advanced

Ask
View Details
CUGBP2, CT (CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR, CUGBP Elav-like family member 2, Bruno-like protein 3, CUG triplet repeat RNA-binding protein 2, CUG-BP-and ETR-3-like factor 2, ELAV-type RNA-binding protein 3, Neuroblastoma apoptosis-related RNA-binding
MBS6290044-01 0.2 mL

CUGBP2, CT (CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR, CUGBP Elav-like family member 2, Bruno-like protein 3, CUG triplet repeat RNA-binding protein 2, CUG-BP-and ETR-3-like factor 2, ELAV-type RNA-binding protein 3, Neuroblastoma apoptosis-related RNA-binding

Ask
View Details
CUGBP2, CT (CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR, CUGBP Elav-like family member 2, Bruno-like protein 3, CUG triplet repeat RNA-binding protein 2, CUG-BP-and ETR-3-like factor 2, ELAV-type RNA-binding protein 3, Neuroblastoma apoptosis-related RNA-binding
MBS6290044-02 5x 0.2 mL

CUGBP2, CT (CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR, CUGBP Elav-like family member 2, Bruno-like protein 3, CUG triplet repeat RNA-binding protein 2, CUG-BP-and ETR-3-like factor 2, ELAV-type RNA-binding protein 3, Neuroblastoma apoptosis-related RNA-binding

Ask
View Details
Plant actin Monoclonal Antibody (Q30)
AMM80015-01 50 µL

Plant actin Monoclonal Antibody (Q30)

Ask
View Details
Plant actin Monoclonal Antibody (Q30)
AMM80015-02 100 µL

Plant actin Monoclonal Antibody (Q30)

Ask
View Details
Mouse HSPb8 ELISA Kit
E055329 1 Each

Mouse HSPb8 ELISA Kit

Ask
View Details