Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMEK1 Rabbit pAb (APR28286N)

Product Specifications

Background

Regulatory subunit of serine/threonine-protein phosphatase 4. May regulate the activity of PPP4C at centrosomal microtubule organizing centers. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AX phosphorylated on 'Ser-140' (gamma-H2AX generated during DNA replication and required for DNA DSB repair.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SMEK1 Rabbit pAb (APR28286N) .

Synonyms

PPP4R3A; FLFL1; KIAA2010; MSTP033; PP4R3; PP4R3A; SMEK1; smk-1; smk1

Gene ID

55671

UniProt

Q6IN85

Cellular Locus

Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 62kDa/67kDa/93kDa/95kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55671

Uniprot URL

https://www.uniprot.org/uniprot/Q6IN85

AA Sequence

VQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDMEDGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDKEDTLPLSKKAKFDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ORAI3 ELISA Kit (Mouse)
OKEH08579-96W 96 Tests

ORAI3 ELISA Kit (Mouse)

Sign In for Pricing
View Details
TAP-Tag Mouse mAb
E47M33133 100 µL

TAP-Tag Mouse mAb

Sign In for Pricing
View Details
Biuret 96% AR
44100025 25 mg

Biuret 96% AR

Sign In for Pricing
View Details
Human SCY1-like protein 2 (SCYL2) ELISA Kit
orb1656050-01 48 Tests

Human SCY1-like protein 2 (SCYL2) ELISA Kit

Sign In for Pricing
View Details
Human SCY1-like protein 2 (SCYL2) ELISA Kit
orb1656050-02 96 Tests

Human SCY1-like protein 2 (SCYL2) ELISA Kit

Sign In for Pricing
View Details
Ziconotide Acetate (107452-89-1 free base)
M24955-01 1 g

Ziconotide Acetate (107452-89-1 free base)

Sign In for Pricing
View Details