Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INADL Rabbit pAb (APR28262N)

Product Specifications

Background

This gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality INADL Rabbit pAb (APR28262N) .

Synonyms

PATJ; Cipp; INADL; InaD-like; hINADL

Gene ID

10207

UniProt

Q8NI35

Cellular Locus

Apical cell membrane, Cell junction, Cell membrane, Cytoplasm, Peripheral membrane protein, perinuclear region, tight junction

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 125kDa/167kDa/170kDa/173kDa/196kDa Observed MW: 255kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10207

Uniprot URL

https://www.uniprot.org/uniprot/Q8NI35

AA Sequence

VRRKTSSSTSPLEPPSDRGTVVEPLKPPALFLTGAVETETNVDGEDEEIKERIDTLKNDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSGGPVDTLGLLQPEDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRRTETSLPETEVDHNMDVNTEEDDDGELALW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TPRBK/TTC28 Antibody Picoband®, HRP Conjugate
A11024-HRP 100 µg/Vial

Anti-TPRBK/TTC28 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
ORM2 Antibody, Biotin conjugated
A45716-50UG 50 µg

ORM2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
RPA1 Rabbit Polyclonal Antibody
53084-01 50 µL

RPA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPA1 Rabbit Polyclonal Antibody
53084-02 100 µL

RPA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CKS2 Protein Vector (Rat) (pPM-C-HA)
PV260196 500 ng

CKS2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
COMMD2 Rabbit Polyclonal Antibody (FITC)
orb186967 100 µL

COMMD2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details