Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOK2 Rabbit pAb (APR28258N)

Product Specifications

Background

The protein encoded by this gene is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210 (bcr/abl), a chimeric protein whose presence is associated with CML. This encoded protein binds p120 (RasGAP) from CML cells.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DOK2 Rabbit pAb (APR28258N) .

Synonyms

DOK2; p56DOK; p56dok-2

Gene ID

9046

UniProt

O60496

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 45kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9046

Uniprot URL

https://www.uniprot.org/uniprot/O60496

AA Sequence

MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVIRLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKELSGPEGKQSRPCMEENELYSSAVTVGPHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNAAPATPQPQPATI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Cysteine rich secretory protein LCCL domain containing 1 (CRISPLD1) ELISA kit
GTR10385864 96 Well

Goat Cysteine rich secretory protein LCCL domain containing 1 (CRISPLD1) ELISA kit

Sign In for Pricing
View Details
Ethyl Propionylacetate-d3
TRC-E925397-10MG 10 mg

Ethyl Propionylacetate-d3

Sign In for Pricing
View Details
Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)
orb2923427-01 20 µg

Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

Sign In for Pricing
View Details
Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)
orb2923427-02 100 µg

Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

Sign In for Pricing
View Details
TRAF5 Rabbit Polyclonal Antibody (Fluoro488)
orb3080329 100 µg

TRAF5 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Rat Nuclear Matrix Protein 66 ELISA Kit
MBS754406-01 48 Well

Rat Nuclear Matrix Protein 66 ELISA Kit

Sign In for Pricing
View Details