Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA6 Rabbit pAb (APR28256N)

Product Specifications

Background

This gene encodes an alpha subunit of neuronal nicotinic acetylcholine receptors. These receptors consist of five subunits and function as ion channels involved in neurotransmission. The encoded protein is a subunit of neuronal nicotinic acetylcholine receptors that mediate dopaminergic neurotransmission and are activated by acetylcholine and exogenous nicotine. Alternatively spliced transcript variants have been observed for this gene. Single nucleotide polymorphisms in this gene have been associated with both nicotine and alcohol dependence.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CHRNA6 Rabbit pAb (APR28256N) .

Synonyms

CHRNA6; CHNRA6

Gene ID

8973

UniProt

Q15825

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa/56kDa Observed MW: 57kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8973

Uniprot URL

https://www.uniprot.org/uniprot/Q15825

AA Sequence

PQVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVVENSEHSPEVEDVINSVQFIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRXN3 (C-term) Rabbit pAb
E2614051 100 µL

NRXN3 (C-term) Rabbit pAb

Sign In for Pricing
View Details
TBCAP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV786804 1.0 µg DNA

TBCAP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
NTPO, 5 g
N030-10 5 g

NTPO, 5 g

Sign In for Pricing
View Details
ZNF831 HDR Plasmid (h)
sc-414334-HDR 20 µg

ZNF831 HDR Plasmid (h)

Sign In for Pricing
View Details
AR CRISPR Knock Out 293T Cell Line (Human)
12233141 1x 10^6 Cells / 1.0 mL

AR CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid Antibody (Clone: 3C6)
29-1007-100 100 µg

SARS-CoV-2 Nucleocapsid Antibody (Clone: 3C6)

Sign In for Pricing
View Details