Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A2 Rabbit pAb (APR28240N)

Product Specifications

Background

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC22A2 Rabbit pAb (APR28240N) .

Synonyms

SLC22A2; 43010; OCT2

Gene ID

6582

UniProt

O15244

Cellular Locus

Membrane, Multi-pass membrane protein

Applications

WB (Rattus norvegicus) IF (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa/54kDa/62kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6582

Uniprot URL

https://www.uniprot.org/uniprot/O15244

AA Sequence

GFTPDHRCRSPGVAELSLRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLGPCRDGWVYETPGSSIVTEFN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant IKKe protein
MBS389174-01 0.02 mg

Recombinant IKKe protein

Sign In for Pricing
View Details
Recombinant IKKe protein
MBS389174-02 1 mg

Recombinant IKKe protein

Sign In for Pricing
View Details
Recombinant IKKe protein
MBS389174-03 5x 1 mg

Recombinant IKKe protein

Sign In for Pricing
View Details
Lentiviral mouse Snrpd2 shRNA (UAS) - Lentiviral mouse Snrpd2 shRNA (UAS, RFP) (100)
GTR15108780 1 Vial

Lentiviral mouse Snrpd2 shRNA (UAS) - Lentiviral mouse Snrpd2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal RDH14 Antibody [Alexa Fluor 405]
NBP3-06302AF405 0.1 mL

Rabbit Polyclonal RDH14 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF605 Antibody
NBP2-56842 100 µL

Rabbit Polyclonal ZNF605 Antibody

Sign In for Pricing
View Details