Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARK1 Rabbit pAb (APR28222N)

Product Specifications

Background

Serine/threonine-protein kinase. Involved in cell polarity and microtubule dynamics regulation. Phosphorylates DCX, MAP2 and MAP4. Phosphorylates the microtubule-associated protein MAPT/TAU. Involved in cell polarity by phosphorylating the microtubule-associated proteins MAP2, MAP4 and MAPT/TAU at KXGS motifs, causing detachment from microtubules, and their disassembly. Involved in the regulation of neuronal migration through its dual activities in regulating cellular polarity and microtubule dynamics, possibly by phosphorylating and regulating DCX. Also acts as a positive regulator of the Wnt signaling pathway, probably by mediating phosphorylation of dishevelled proteins (DVL1, DVL2 and/or DVL3.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MARK1 Rabbit pAb (APR28222N) .

Synonyms

MARK1; MARK; Par-1c; Par1c

Gene ID

4139

UniProt

Q9P0L2

Cellular Locus

Cell membrane, Cytoplasm, Peripheral membrane protein, cytoskeleton

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 72kDa/84kDa/89kDa Observed MW: 95kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4139

Uniprot URL

https://www.uniprot.org/uniprot/Q9P0L2

AA Sequence

HPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHGEQLRERRSVAYNGPPASPSHETGAFAHARRGTSTGIISKITSKFVRRDPSEGEASGRTDTSRSTSGEPKERDKEEGKDSKPRSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9Z,11E,13E-Octadecatrienoic Acid Ethyl Ester
440569-01 1 mg

9Z,11E,13E-Octadecatrienoic Acid Ethyl Ester

Sign In for Pricing
View Details
9Z,11E,13E-Octadecatrienoic Acid Ethyl Ester
440569-02 2.5 mg

9Z,11E,13E-Octadecatrienoic Acid Ethyl Ester

Sign In for Pricing
View Details
PF-4 Rabbit Polyclonal Antibody
E28PT6006 100 µL

PF-4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CHST10 (NM_004854) Human Over-expression Lysate
LY417701 100 µg

CHST10 (NM_004854) Human Over-expression Lysate

Sign In for Pricing
View Details
Fabp6 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3343704 1.0 µg DNA

Fabp6 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Goat anti-CMG1 / CCDC2 / IFT74 Antibody
orb413169 100 µg

Goat anti-CMG1 / CCDC2 / IFT74 Antibody

Sign In for Pricing
View Details