MARK1 Rabbit pAb (APR28222N)
Product Specifications
Background
Serine/threonine-protein kinase. Involved in cell polarity and microtubule dynamics regulation. Phosphorylates DCX, MAP2 and MAP4. Phosphorylates the microtubule-associated protein MAPT/TAU. Involved in cell polarity by phosphorylating the microtubule-associated proteins MAP2, MAP4 and MAPT/TAU at KXGS motifs, causing detachment from microtubules, and their disassembly. Involved in the regulation of neuronal migration through its dual activities in regulating cellular polarity and microtubule dynamics, possibly by phosphorylating and regulating DCX. Also acts as a positive regulator of the Wnt signaling pathway, probably by mediating phosphorylation of dishevelled proteins (DVL1, DVL2 and/or DVL3.
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MARK1 Rabbit pAb (APR28222N) .
Synonyms
MARK1; MARK; Par-1c; Par1c
Gene ID
4139
UniProt
Q9P0L2
Cellular Locus
Cell membrane, Cytoplasm, Peripheral membrane protein, cytoskeleton
Dilution
WB 1:500 - 1:2000 IHC 1:50 - 1:200
Form
Liquid
Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Molecular Weight
Calculated MW: 72kDa/84kDa/89kDa Observed MW: 95kDa
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Gene ID URL
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4139
Uniprot URL
https://www.uniprot.org/uniprot/Q9P0L2
AA Sequence
HPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHGEQLRERRSVAYNGPPASPSHETGAFAHARRGTSTGIISKITSKFVRRDPSEGEASGRTDTSRSTSGEPKERDKEEGKDSKPRSL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
T7655 1x106 cells / 1.0 mL
HPV16 E6 Over-expressing Hacat Stable Cell Line-Clone 2
Sign In for Pricing
View Details 
MBS6450785-01 0.1 mL
CYP51A1 (Cytochrome P450, Family 51, Subfamily A, Polypeptide 1, CP51, CYP51, CYPL1, LDM, P450-14DM, P450L1) (Biotin)
Sign In for Pricing
View Details MBS6450785-02 5x 0.1 mL
CYP51A1 (Cytochrome P450, Family 51, Subfamily A, Polypeptide 1, CP51, CYP51, CYPL1, LDM, P450-14DM, P450L1) (Biotin)
Sign In for Pricing
View Details RD-S100A8-b-01 96 Tests
Bovine S100 Calcium Binding Protein A8 (S100A8) ELISA Kit
Sign In for Pricing
View Details