Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNJ4 Rabbit pAb (APR28221N)

Product Specifications

Background

Several different potassium channels are known to be involved with electrical signaling in the nervous system. One class is activated by depolarization whereas a second class is not. The latter are referred to as inwardly rectifying K+ channels, and they have a greater tendency to allow potassium to flow into the cell rather than out of it. This asymmetry in potassium ion conductance plays a key role in the excitability of muscle cells and neurons. The protein encoded by this gene is an integral membrane protein and member of the inward rectifier potassium channel family. The encoded protein has a small unitary conductance compared to other members of this protein family. Two transcript variants encoding the same protein have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KCNJ4 Rabbit pAb (APR28221N) .

Synonyms

KCNJ4; HIR; HIRK2; HRK1; IRK-3; IRK3; Kir2.3

Gene ID

3761

UniProt

P48050

Cellular Locus

Cell junction, Cell membrane, Cytoplasmic vesicle membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3761

Uniprot URL

https://www.uniprot.org/uniprot/P48050

AA Sequence

HRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ticam2 (NM_173394) Mouse Recombinant Protein
PM42637M5 20 µg

Ticam2 (NM_173394) Mouse Recombinant Protein

Sign In for Pricing
View Details
ALAS1 Rabbit Polyclonal Antibody (PerCP)
orb2375496 100 µL

ALAS1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
TRMU Antibody
30-454 100 µL

TRMU Antibody

Sign In for Pricing
View Details
Histone H1 (1415-1), CF647 conjugate, 0.1mg/mL
BNC470580-500 1x 500 µL

Histone H1 (1415-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lentiviral human KNG1 shRNA (UAS) - Lentiviral human KNG1 shRNA (UAS, GFP) (100)
GTR15118449 1 Vial

Lentiviral human KNG1 shRNA (UAS) - Lentiviral human KNG1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
1-O-Acyl ceramide (d18:1/16:0/24:1)
HY-N15861 1 Each

1-O-Acyl ceramide (d18:1/16:0/24:1)

Sign In for Pricing
View Details