Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNB2 Rabbit pAb (APR28209N)

Product Specifications

Background

Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5' UTR.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GNB2 Rabbit pAb (APR28209N) .

Synonyms

GNB2

Gene ID

2783

UniProt

P62879

Cellular Locus

Cytoplasm, perinuclear region

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/37kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2783

Uniprot URL

https://www.uniprot.org/uniprot/P62879

AA Sequence

MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZZEF1 Recombinant Protein Antigen
NBP1-83827PEP 0.1 mL

ZZEF1 Recombinant Protein Antigen

Sign In for Pricing
View Details
GDPD3 Rabbit Polyclonal Antibody (BF488)
orb2378399 100 µL

GDPD3 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Mbl2 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6093903 1.0 µg DNA

Mbl2 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
MFSD2A Polyclonal Antibody
BS65939-01 50 µL

MFSD2A Polyclonal Antibody

Sign In for Pricing
View Details
MFSD2A Polyclonal Antibody
BS65939-02 100 µL

MFSD2A Polyclonal Antibody

Sign In for Pricing
View Details
DNCLI1 Polyclonal Antibody, RBITC Conjugated
bs-20152R-RBITC 100 µL

DNCLI1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details