Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glucosylceramidase beta (GBA) Rabbit pAb (APR28207N)

Product Specifications

Background

This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Glucosylceramidase beta (GBA) Rabbit pAb (APR28207N) .

Synonyms

GBA; GBA1; GCB; GLUC

Gene ID

2629

UniProt

P04062

Cellular Locus

Lumenal side, Lysosome membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/50kDa/54kDa/57kDa/59kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2629

Uniprot URL

https://www.uniprot.org/uniprot/P04062

AA Sequence

ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGSLKGQPGDIYHQTWAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinoid-Binding Protein 7 (RBP7) Antibody
abx029777-01 80 µL

Retinoid-Binding Protein 7 (RBP7) Antibody

Sign In for Pricing
View Details
Retinoid-Binding Protein 7 (RBP7) Antibody
abx029777-02 400 µL

Retinoid-Binding Protein 7 (RBP7) Antibody

Sign In for Pricing
View Details
GDF15, CT (Growth/Differentiation Factor 15, GDF-15, Placental Bone Morphogenetic Protein, Placental TGF-beta, Macrophage Inhibitory Cytokine 1, MIC-1, Prostate Differentiation Factor, NSAID-activated Gene 1 Protein, NAG-1, NSAID-regulated Gene 1 Protein, NRG-1, MIC1, PDF, PLAB, PTGFB) discontinued
G8989-50D 50 µg

GDF15, CT (Growth/Differentiation Factor 15, GDF-15, Placental Bone Morphogenetic Protein, Placental TGF-beta, Macrophage Inhibitory Cytokine 1, MIC-1, Prostate Differentiation Factor, NSAID-activated Gene 1 Protein, NAG-1, NSAID-regulated Gene 1 Protein, NRG-1, MIC1, PDF, PLAB, PTGFB) discontinued

Sign In for Pricing
View Details
Ms4a6c (NM_028595) Mouse Tagged ORF Clone
MR219253 10 µg

Ms4a6c (NM_028595) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Fam76a sgRNA CRISPR Lentivector (Rat) (Target 1)
K6600702 1.0 µg DNA

Fam76a sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Myostatin (MSTN)
MBS2057558-01 0.1 mL

PE-Linked Polyclonal Antibody to Myostatin (MSTN)

Sign In for Pricing
View Details