Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glucosylceramidase beta (GBA) Rabbit pAb (APR28207N)

Product Specifications

Background

This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Glucosylceramidase beta (GBA) Rabbit pAb (APR28207N) .

Synonyms

GBA; GBA1; GCB; GLUC

Gene ID

2629

UniProt

P04062

Cellular Locus

Lumenal side, Lysosome membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/50kDa/54kDa/57kDa/59kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2629

Uniprot URL

https://www.uniprot.org/uniprot/P04062

AA Sequence

ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGSLKGQPGDIYHQTWAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA9 (GRP75, HSPA9B, Stress-70 Protein, Mitochondrial, 75kD Glucose-regulated Protein, Heat Shock 70kD Protein 9, Mortalin, Peptide-binding Protein 74, MGC4500) (MaxLight 550)
128134-ML550 100 µL

HSPA9 (GRP75, HSPA9B, Stress-70 Protein, Mitochondrial, 75kD Glucose-regulated Protein, Heat Shock 70kD Protein 9, Mortalin, Peptide-binding Protein 74, MGC4500) (MaxLight 550)

Sign In for Pricing
View Details
TNFSF15, Recombinant, Human, Active (Tumor Necrosis Factor Ligand Superfamily Member 15, TNF Ligand-related Molecule 1, TL1, TL1A, Vascular Endothelial Cell Growth Inhibitor, VEGI, VEGI192A)
149658-01 5 µg

TNFSF15, Recombinant, Human, Active (Tumor Necrosis Factor Ligand Superfamily Member 15, TNF Ligand-related Molecule 1, TL1, TL1A, Vascular Endothelial Cell Growth Inhibitor, VEGI, VEGI192A)

Sign In for Pricing
View Details
TNFSF15, Recombinant, Human, Active (Tumor Necrosis Factor Ligand Superfamily Member 15, TNF Ligand-related Molecule 1, TL1, TL1A, Vascular Endothelial Cell Growth Inhibitor, VEGI, VEGI192A)
149658-02 20 µg

TNFSF15, Recombinant, Human, Active (Tumor Necrosis Factor Ligand Superfamily Member 15, TNF Ligand-related Molecule 1, TL1, TL1A, Vascular Endothelial Cell Growth Inhibitor, VEGI, VEGI192A)

Sign In for Pricing
View Details
MS4A6A (4SPAN3, CD20L3, MS4A6, Membrane-spanning 4-domains Subfamily A Member 6A, CD20 Antigen-like 3, Four-span Transmembrane Protein 3, MGC131944, MGC22650, MST090) (MaxLight 550)
129912-ML550 100 µL

MS4A6A (4SPAN3, CD20L3, MS4A6, Membrane-spanning 4-domains Subfamily A Member 6A, CD20 Antigen-like 3, Four-span Transmembrane Protein 3, MGC131944, MGC22650, MST090) (MaxLight 550)

Sign In for Pricing
View Details
Pdlim1 Rat siRNA Oligo Duplex (Locus ID 54133)
SR508454 1 Kit

Pdlim1 Rat siRNA Oligo Duplex (Locus ID 54133)

Sign In for Pricing
View Details
Sec22c sgRNA CRISPR Lentivector set (Mouse)
K4508501 3x 1.0 µg

Sec22c sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details