Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL3 Rabbit pAb (APR28160N)

Product Specifications

Background

This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality METTL3 Rabbit pAb (APR28160N) .

Synonyms

IME4; M6A; MT-A70; Spo8; hMETTL3; METTL3

Gene ID

56339

UniProt

Q86U44

Cellular Locus

Nucleus speckle

Applications

WB (Human breast cancer, HeLa, Homo sapiens, Mus musculus, Rattus norvegicus) IF (Human breast cancer, Homo sapiens, Mus musculus) RIP (Homo sapiens) Co-IP (Homo sapiens) IHC (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:20 - 1:50

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/64kDa Observed MW: 70KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=56339

Uniprot URL

https://www.uniprot.org/uniprot/Q86U44

AA Sequence

MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGGPKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLLQKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GJE1 sgRNA gene knockout kit - Lentiviral human GJE1 sgRNA gene knockout kit (100)
GTR15378634 1 Vial

Lentiviral human GJE1 sgRNA gene knockout kit - Lentiviral human GJE1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
BMS-5 50mg
A12839-50 50 mg

BMS-5 50mg

Sign In for Pricing
View Details
Human KRT4 Knockout A549 cell line
GTR15415988 1 Vial

Human KRT4 Knockout A549 cell line

Sign In for Pricing
View Details
FITC/Fluorescein isothiocyanate Monoclonal Antibody
E55A11288 100 µL

FITC/Fluorescein isothiocyanate Monoclonal Antibody

Sign In for Pricing
View Details
DCP2 Antibody
MBS9429979-01 0.1 mL

DCP2 Antibody

Sign In for Pricing
View Details
DCP2 Antibody
MBS9429979-02 5x 0.1 mL

DCP2 Antibody

Sign In for Pricing
View Details