Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO22 Rabbit pAb (APR28157N)

Product Specifications

Background

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and, as a transcriptional target of the tumor protein p53, is thought to be involved in degradation of specific proteins in response to p53 induction. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FBXO22 Rabbit pAb (APR28157N) .

Synonyms

FBXO22; FBX22; FISTC1

Gene ID

26263

UniProt

Q8NEZ5

Cellular Locus

Cytoplasm, Z line, myofibril, sarcomere

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 4kDa/30kDa/44kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26263

Uniprot URL

https://www.uniprot.org/uniprot/Q8NEZ5

AA Sequence

YMADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR4A2 (Nuclear Receptor Subfamily 4, Group A, Member 2, HZF-3, NOT, NURR1, RNR1, TINUR) (MaxLight 405) discontinued
249471-ML405 100 µL

NR4A2 (Nuclear Receptor Subfamily 4, Group A, Member 2, HZF-3, NOT, NURR1, RNR1, TINUR) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal SMPDL3A Antibody [DyLight 550]
NBP3-00152R 0.1 mL

Rabbit Polyclonal SMPDL3A Antibody [DyLight 550]

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to MAP1LC3B
MBS8527606-01 0.1 mL

Mouse Monoclonal Antibody to MAP1LC3B

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to MAP1LC3B
MBS8527606-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to MAP1LC3B

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to MAP1LC3B
MBS8527606-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to MAP1LC3B

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to MAP1LC3B
MBS8527606-04 0.1 mL (AF610)

Mouse Monoclonal Antibody to MAP1LC3B

Sign In for Pricing
View Details