Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R1 Rabbit pAb (APR28151N)

Product Specifications

Background

This gene encodes one of several alternate regulatory subunits of serine/threonine protein phosphatase 4 (PP4) . The protein features multiple HEAT repeats. This protein forms a complex with PP4RC. This complex may have a distinct role from other PP4 complexes, including regulation of HDAC3 (Zhang et al., PMID: 15805470) . There is also a transcribed pseudogene on chromosome 20. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PPP4R1 Rabbit pAb (APR28151N) .

Synonyms

PPP4R1; MEG1; PP4 (Rmeg) ; PP4R1

Gene ID

9989

UniProt

Q8TF05

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IP 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 105kDa/107kDa Observed MW: 130kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9989

Uniprot URL

https://www.uniprot.org/uniprot/Q8TF05

AA Sequence

NPSSSGQYFKEESKSSEEMSVENKNRTRDQEAPEDVQVRPEDTPSDLSVSNSSVILENTMEDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAASNENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSGGKPSPEGPEEESEGPVPSSPNITMATRKELEEMIENLEPHIDDPDVKAQVEVLSAALRASSLDAHEETISIEKRSDLQDELDINELPNCKINQEDSVPLISDAVENMDSTLHYIHSDSDLSNNSSFSPDEERRTKVQDVVPQALLDQYLSMTDPSRAQTVDTEIAKHCAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal SynGAP Antibody (HL2292) - Azide and BSA Free
NBP3-25707 100 µL

Rabbit Monoclonal SynGAP Antibody (HL2292) - Azide and BSA Free

Sign In for Pricing
View Details
Recombinant Salmonella dublin Nucleoside diphosphate kinase (ndk)
MBS1179389-01 0.02 mg (E-Coli)

Recombinant Salmonella dublin Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Salmonella dublin Nucleoside diphosphate kinase (ndk)
MBS1179389-02 0.1 mg (E-Coli)

Recombinant Salmonella dublin Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Salmonella dublin Nucleoside diphosphate kinase (ndk)
MBS1179389-03 0.02 mg (Yeast)

Recombinant Salmonella dublin Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Salmonella dublin Nucleoside diphosphate kinase (ndk)
MBS1179389-04 0.1 mg (Yeast)

Recombinant Salmonella dublin Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Salmonella dublin Nucleoside diphosphate kinase (ndk)
MBS1179389-05 0.02 mg (Baculovirus)

Recombinant Salmonella dublin Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details