Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF11 Rabbit pAb (APR28124N)

Product Specifications

Background

The protein encoded by this gene contains a RING-H2 finger motif, which is known to be important for protein-protein interactions. The expression of this gene has been shown to be induced by mutant RET proteins (MEN2A/MEN2B) . The germline mutations in RET gene are known to be responsible for the development of multiple endocrine neoplasia (MEN) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RNF11 Rabbit pAb (APR28124N) .

Synonyms

RNF11; CGI-123; SID1669

Gene ID

26994

UniProt

Q9Y3C5

Cellular Locus

Cytoplasm, Early endosome, Nucleus, Recycling endosome

Applications

WB (Mus musculus) ELISA (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa Observed MW: 27kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26994

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y3C5

AA Sequence

MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FOLH1 (Farletuzumab)-MC-Vc-PAB-MMAE ADC
ADC-W-1169 1 mg

Anti-FOLH1 (Farletuzumab)-MC-Vc-PAB-MMAE ADC

Sign In for Pricing
View Details
API5 Rabbit Polyclonal Antibody (BF647)
orb2450998 100 µL

API5 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Human C-Type Natriuretic Peptide (CNP) ELISA Kit
RDR-CNP-Hu-96Tests 96 Tests

Human C-Type Natriuretic Peptide (CNP) ELISA Kit

Sign In for Pricing
View Details
Cryzl1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
16898116 3x 1.0 µg

Cryzl1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
MHC class I Polyclonal Antibody, Biotin Conjugated
bs-18070R-Biotin 100 µL

MHC class I Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
C-di-AMP (diammonium)
HY-12326B-01 500 µg

C-di-AMP (diammonium)

Sign In for Pricing
View Details