Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA1 Rabbit pAb (APR28122N)

Product Specifications

Background

The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the 'hydrophobic protein' (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NDUFA1 Rabbit pAb (APR28122N) .

Synonyms

NDUFA1; CI-MWFE; MWFE; ZNF183

Gene ID

4694

UniProt

O15239

Cellular Locus

Matrix side, Mitochondrion inner membrane, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 8kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4694

Uniprot URL

https://www.uniprot.org/uniprot/O15239

AA Sequence

MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PP2Cε (m) -PR
sc-152397-PR 10 µM - 20 µL

PP2Cε (m) -PR

Sign In for Pricing
View Details
Prostate Specific Antigen/Antichymotrypsin (PSA, ACT) (Biotin) discontinued
P9054-55A-Biotin 100 µL

Prostate Specific Antigen/Antichymotrypsin (PSA, ACT) (Biotin) discontinued

Sign In for Pricing
View Details
FXR1 Rabbit Polyclonal Antibody
54943-01 50 µL

FXR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FXR1 Rabbit Polyclonal Antibody
54943-02 100 µL

FXR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GluAP (Glutamyl Aminopeptidase, CD249, ENPEP, gp160, ATA, EAP, AP-A, Aminopeptidase A)
363315 200 µL

GluAP (Glutamyl Aminopeptidase, CD249, ENPEP, gp160, ATA, EAP, AP-A, Aminopeptidase A)

Sign In for Pricing
View Details
PKM2, CT (N491) (Pyruvate Kinase, Isozymes M1/M2, Pyruvate Kinase Muscle Isozyme, Cytosolic Thyroid Hormone-binding Protein, CTHBP, Opa-interacting Protein 3, OIP-3, Pyruvate Kinase 2/3, Thyroid Hormone-binding Protein 1, THBP1, Tumor M2-PK, p58, PKM, OIP3, PK2, PK3) (Azide free) (HRP)
P9545-31H-HRP 200 µL

PKM2, CT (N491) (Pyruvate Kinase, Isozymes M1/M2, Pyruvate Kinase Muscle Isozyme, Cytosolic Thyroid Hormone-binding Protein, CTHBP, Opa-interacting Protein 3, OIP-3, Pyruvate Kinase 2/3, Thyroid Hormone-binding Protein 1, THBP1, Tumor M2-PK, p58, PKM, OIP3, PK2, PK3) (Azide free) (HRP)

Sign In for Pricing
View Details