Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C8B Rabbit pAb (APR28120N)

Product Specifications

Background

This gene encodes one of the three subunits of the complement component 8 (C8) protein. C8 is composed of equimolar amounts of alpha, beta and gamma subunits, which are encoded by three separate genes. C8 is one component of the membrane attack complex, which mediates cell lysis, and it initiates membrane penetration of the complex. This protein mediates the interaction of C8 with the C5b-7 membrane attack complex precursor. In humans deficiency of this protein is associated with increased risk of meningococcal infections. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality C8B Rabbit pAb (APR28120N) .

Synonyms

C8B; C82

Gene ID

732

UniProt

P07358

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 67kDa Observed MW: 67kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=732

Uniprot URL

https://www.uniprot.org/uniprot/P07358

AA Sequence

SVDVTLMPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Stag2 shRNA (UAS) - Lentiviral mouse Stag2 shRNA (UAS, iRFP) (100)
GTR15228543 1 Vial

Lentiviral mouse Stag2 shRNA (UAS) - Lentiviral mouse Stag2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Human Anti-Apolipoprotein A1 Antibody (Anti-APOA1) ELISA Kit
abx252035-01 96 Tests

Human Anti-Apolipoprotein A1 Antibody (Anti-APOA1) ELISA Kit

Sign In for Pricing
View Details
Human Anti-Apolipoprotein A1 Antibody (Anti-APOA1) ELISA Kit
abx252035-02 5x 96 Tests

Human Anti-Apolipoprotein A1 Antibody (Anti-APOA1) ELISA Kit

Sign In for Pricing
View Details
Human Anti-Apolipoprotein A1 Antibody (Anti-APOA1) ELISA Kit
abx252035-03 10x 96 Tests

Human Anti-Apolipoprotein A1 Antibody (Anti-APOA1) ELISA Kit

Sign In for Pricing
View Details
Anti-S100B Monoclonal antibody (1G1)
MBS1567785-01 0.1 mg

Anti-S100B Monoclonal antibody (1G1)

Sign In for Pricing
View Details
Anti-S100B Monoclonal antibody (1G1)
MBS1567785-02 5x 0.1 mg

Anti-S100B Monoclonal antibody (1G1)

Sign In for Pricing
View Details