Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS22 Rabbit pAb (APR28115N)

Product Specifications

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that does not seem to have a counterpart in prokaryotic and fungal-mitochondrial ribosomes. This gene lies telomeric of and is transcribed in the opposite direction from the forkhead box L2 gene. A pseudogene corresponding to this gene is found on chromosome Xq.

Synonyms

MRPS22; C3orf5; COXPD5; GIBT; GK002; MRP-S22; RPMS22

Gene ID

56945

UniProt

P82650

Cellular Locus

Mitochondrion

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa/41kDa Observed MW: 41kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MRPS22 Rabbit pAb (APR28115N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=56945

Uniprot URL

https://www.uniprot.org/uniprot/P82650

AA Sequence

MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TMEM188 CRISPRa sgRNA lentivector (set of three targets)(Rat)
46966126 3 x 1.0μg DNA

TMEM188 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Ask
View Details
KIRREL3 (Kin of IRRE-like protein 3, Kin of irregular chiasm-like protein 3, Nephrin-like protein 2, KIAA1867, NEPH2, UNQ5923/PRO4502/PRO19814, MGC126824, MGC126850) (MaxLight 405)
MBS6190862-01 0.1 mL

KIRREL3 (Kin of IRRE-like protein 3, Kin of irregular chiasm-like protein 3, Nephrin-like protein 2, KIAA1867, NEPH2, UNQ5923/PRO4502/PRO19814, MGC126824, MGC126850) (MaxLight 405)

Ask
View Details
KIRREL3 (Kin of IRRE-like protein 3, Kin of irregular chiasm-like protein 3, Nephrin-like protein 2, KIAA1867, NEPH2, UNQ5923/PRO4502/PRO19814, MGC126824, MGC126850) (MaxLight 405)
MBS6190862-02 5x 0.1 mL

KIRREL3 (Kin of IRRE-like protein 3, Kin of irregular chiasm-like protein 3, Nephrin-like protein 2, KIAA1867, NEPH2, UNQ5923/PRO4502/PRO19814, MGC126824, MGC126850) (MaxLight 405)

Ask
View Details
TCEA1 (B-6) Alexa Fluor® 594
sc-393520 AF594 200 µg/mL

TCEA1 (B-6) Alexa Fluor® 594

Ask
View Details
Recombinant Flavobacterium johnsoniae Non-canonical purine NTP pyrophosphatase (Fjoh_2403)
MBS1051123-01 0.02 mg (E-Coli)

Recombinant Flavobacterium johnsoniae Non-canonical purine NTP pyrophosphatase (Fjoh_2403)

Ask
View Details
Recombinant Flavobacterium johnsoniae Non-canonical purine NTP pyrophosphatase (Fjoh_2403)
MBS1051123-02 0.1 mg (E-Coli)

Recombinant Flavobacterium johnsoniae Non-canonical purine NTP pyrophosphatase (Fjoh_2403)

Ask
View Details