Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS22 Rabbit pAb (APR28115N)

Product Specifications

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that does not seem to have a counterpart in prokaryotic and fungal-mitochondrial ribosomes. This gene lies telomeric of and is transcribed in the opposite direction from the forkhead box L2 gene. A pseudogene corresponding to this gene is found on chromosome Xq.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MRPS22 Rabbit pAb (APR28115N) .

Synonyms

MRPS22; C3orf5; COXPD5; GIBT; GK002; MRP-S22; RPMS22

Gene ID

56945

UniProt

P82650

Cellular Locus

Mitochondrion

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa/41kDa Observed MW: 41kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=56945

Uniprot URL

https://www.uniprot.org/uniprot/P82650

AA Sequence

MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RFP negative transgenic cell lines (HEK293T cells containing RFP dead mutant at AAVS1 locus)
GE100041C 1 Vial

RFP negative transgenic cell lines (HEK293T cells containing RFP dead mutant at AAVS1 locus)

Ask
View Details
ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (HRP)
MBS6151347-01 0.1 mL

ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (HRP)

Ask
View Details
ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (HRP)
MBS6151347-02 5x 0.1 mL

ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (HRP)

Ask
View Details
mLH1 (NM_000249) Human Mutant ORF Clone
RC401656 10 µg

mLH1 (NM_000249) Human Mutant ORF Clone

Ask
View Details
MARK1 Antibody
A49093-100UL 100 µL

MARK1 Antibody

Ask
View Details
Tissue Protein Lysate, Ovary
CP565731 150 µg

Tissue Protein Lysate, Ovary

Ask
View Details