Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERLIN2 Rabbit pAb (APR28110N)

Product Specifications

Background

This gene encodes a member of the SPFH domain-containing family of lipid raft-associated proteins. The encoded protein is localized to lipid rafts of the endoplasmic reticulum and plays a critical role in inositol 1,4,5-trisphosphate (IP3) signaling by mediating ER-associated degradation of activated IP3 receptors. Mutations in this gene are a cause of spastic paraplegia-18 (SPG18) . Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ERLIN2 Rabbit pAb (APR28110N) .

Synonyms

ERLIN2; C8orf2; Erlin-2; NET32; SPFH2; SPG18; erlin-2

Gene ID

11160

UniProt

O94905

Cellular Locus

Endoplasmic reticulum membrane, Single-pass type II membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa/22kDa/37kDa Observed MW: 38kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11160

Uniprot URL

https://www.uniprot.org/uniprot/O94905

AA Sequence

KIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFGLENDFSQESS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GPR162 Protein - (Dry Ice)
H00027239-P01-2ug 2 µg

Recombinant Human GPR162 Protein - (Dry Ice)

Sign In for Pricing
View Details
GCN2 (F-7)
sc-374609 200 µg/mL

GCN2 (F-7)

Sign In for Pricing
View Details
CLDN7 Rabbit Polyclonal Antibody (BF750)
orb2383144 100 µL

CLDN7 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
RGD1564345 (Tex47) (NM_001077681) Rat Tagged Lenti ORF Clone
RR211215L3 10 µg

RGD1564345 (Tex47) (NM_001077681) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cdc25B shRNA (m) Lentiviral Particles
sc-37553-V 200 µL

Cdc25B shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
PFK-1 CRISPR Activation Plasmid (m2)
sc-422205-ACT-2 20 µg

PFK-1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details