Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FZD9 Rabbit pAb (APR28107N)

Product Specifications

Background

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD9 gene is located within the Williams syndrome common deletion region of chromosome 7, and heterozygous deletion of the FZD9 gene may contribute to the Williams syndrome phenotype. FZD9 is expressed predominantly in brain, testis, eye, skeletal muscle, and kidney.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FZD9 Rabbit pAb (APR28107N) .

Synonyms

FZD9; CD349; FZD3

Gene ID

8326

UniProt

O00144

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 64kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8326

Uniprot URL

https://www.uniprot.org/uniprot/O00144

AA Sequence

ERLNMDFWRLRATEQPCAAAAGPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKIAAGRARAKACRAPGSYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH3A1 Rabbit Polyclonal Antibody
orb1147795 100 µg

ALDH3A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GHRH Recombinant Protein
OPCA01615-20UG 20 µg

GHRH Recombinant Protein

Sign In for Pricing
View Details
Calpain 2 (E-10) : m-IgG Fc BP-HRP Bundle
sc-527427 1 Kit

Calpain 2 (E-10) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
THBS3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46643111 3x 1.0 µg

THBS3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CD40/TNFRSF5 Rabbit Polyclonal Antibody (PerCP)
orb2433865 100 µL

CD40/TNFRSF5 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Cis- (-) -1,3-Dibenzylhexahydro-2-oxo-1H-thieno[3,4-d]imidazole-4-valeric Acid
sc-500533 10 mg

Cis- (-) -1,3-Dibenzylhexahydro-2-oxo-1H-thieno[3,4-d]imidazole-4-valeric Acid

Sign In for Pricing
View Details