Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FZD9 Rabbit pAb (APR28107N)

Product Specifications

Background

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD9 gene is located within the Williams syndrome common deletion region of chromosome 7, and heterozygous deletion of the FZD9 gene may contribute to the Williams syndrome phenotype. FZD9 is expressed predominantly in brain, testis, eye, skeletal muscle, and kidney.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FZD9 Rabbit pAb (APR28107N) .

Synonyms

FZD9; CD349; FZD3

Gene ID

8326

UniProt

O00144

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 64kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8326

Uniprot URL

https://www.uniprot.org/uniprot/O00144

AA Sequence

ERLNMDFWRLRATEQPCAAAAGPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKIAAGRARAKACRAPGSYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

na Human shRNA Lentiviral Particle (Locus ID 148640)
TL317944V 500 µL Each

na Human shRNA Lentiviral Particle (Locus ID 148640)

Sign In for Pricing
View Details
Deoxyguanosine kinase (DGUOK) CytoSection
TS404891P5 25 Slides

Deoxyguanosine kinase (DGUOK) CytoSection

Sign In for Pricing
View Details
HTRA4 protein, Human, Recombinant (His)
E51P91465 20 µg

HTRA4 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
SARS-CoV-2 NSP14/Exonuclease/SARS Rabbit Polyclonal Antibody (FITC)
orb2602750 100 µg

SARS-CoV-2 NSP14/Exonuclease/SARS Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
NUMA1 Protein Vector (Human) (pPM-C-HA)
32312021 500 ng

NUMA1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Ldlr qPCR Primer Pair
QM03722S 200 Tests

Mouse Ldlr qPCR Primer Pair

Sign In for Pricing
View Details