Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FZD9 Rabbit pAb (APR28107N)

Product Specifications

Background

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD9 gene is located within the Williams syndrome common deletion region of chromosome 7, and heterozygous deletion of the FZD9 gene may contribute to the Williams syndrome phenotype. FZD9 is expressed predominantly in brain, testis, eye, skeletal muscle, and kidney.

Synonyms

FZD9; CD349; FZD3

Gene ID

8326

UniProt

O00144

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 64kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FZD9 Rabbit pAb (APR28107N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8326

Uniprot URL

https://www.uniprot.org/uniprot/O00144

AA Sequence

ERLNMDFWRLRATEQPCAAAAGPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKIAAGRARAKACRAPGSYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SLMAP (AB046821) Human Untagged Clone
SC314404 10 µg

SLMAP (AB046821) Human Untagged Clone

Ask
View Details
Il13ra2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
24821116 3 x 1.0 µg

Il13ra2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Ask
View Details
PSMD7 Human shRNA Plasmid Kit (Locus ID 5713)
TR310093 1 Kit

PSMD7 Human shRNA Plasmid Kit (Locus ID 5713)

Ask
View Details
Amersham Protran Prem. 20cm x 4m
10600008 1 ROLL

Amersham Protran Prem. 20cm x 4m

Ask
View Details
HLA-DMB (Major Histocompatibility Complex, Class II, DM beta, MHC class II HLA-DMB, MHC Class II Antigen HLA-DM beta Chain, OTTHUMP00000029257, Class II Histocompatibility Antigen, M beta Chain, D6S221E, RING7) APC
MBS6140130-01 0.1 mL

HLA-DMB (Major Histocompatibility Complex, Class II, DM beta, MHC class II HLA-DMB, MHC Class II Antigen HLA-DM beta Chain, OTTHUMP00000029257, Class II Histocompatibility Antigen, M beta Chain, D6S221E, RING7) APC

Ask
View Details
HLA-DMB (Major Histocompatibility Complex, Class II, DM beta, MHC class II HLA-DMB, MHC Class II Antigen HLA-DM beta Chain, OTTHUMP00000029257, Class II Histocompatibility Antigen, M beta Chain, D6S221E, RING7) APC
MBS6140130-02 5x 0.1 mL

HLA-DMB (Major Histocompatibility Complex, Class II, DM beta, MHC class II HLA-DMB, MHC Class II Antigen HLA-DM beta Chain, OTTHUMP00000029257, Class II Histocompatibility Antigen, M beta Chain, D6S221E, RING7) APC

Ask
View Details