Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FZD9 Rabbit pAb (APR28107N)

Product Specifications

Background

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD9 gene is located within the Williams syndrome common deletion region of chromosome 7, and heterozygous deletion of the FZD9 gene may contribute to the Williams syndrome phenotype. FZD9 is expressed predominantly in brain, testis, eye, skeletal muscle, and kidney.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FZD9 Rabbit pAb (APR28107N) .

Synonyms

FZD9; CD349; FZD3

Gene ID

8326

UniProt

O00144

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 64kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8326

Uniprot URL

https://www.uniprot.org/uniprot/O00144

AA Sequence

ERLNMDFWRLRATEQPCAAAAGPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKIAAGRARAKACRAPGSYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fabp5 AAV siRNA Pooled Vector
19640164 1.0 µg

Fabp5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
DOCK9 (NM_001130049) Human Tagged ORF Clone Lentiviral Particle
RC226374L3V 200 µL

DOCK9 (NM_001130049) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PWWP2A (NM_001130864) Human Tagged ORF Clone
RC226141 10 µg

PWWP2A (NM_001130864) Human Tagged ORF Clone

Sign In for Pricing
View Details
Fasn sgRNA CRISPR Lentivector (Rat) (Target 1)
K6876902 1.0 µg DNA

Fasn sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Mouse GM-CSF Recombinant (CHO cell)
MBS554049-01 0.005 mg

Mouse GM-CSF Recombinant (CHO cell)

Sign In for Pricing
View Details
Mouse GM-CSF Recombinant (CHO cell)
MBS554049-02 0.02 mg

Mouse GM-CSF Recombinant (CHO cell)

Sign In for Pricing
View Details