Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL36G Rabbit pAb (APR28100N)

Product Specifications

Background

The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta) . Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IL36G Rabbit pAb (APR28100N) .

Synonyms

IL36G; IL-1F9; IL-1H1; IL-1RP2; IL1E; IL1F9; IL1H1; IL1RP2

Gene ID

56300

UniProt

Q9NZH8

Cellular Locus

Secreted

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/18kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=56300

Uniprot URL

https://www.uniprot.org/uniprot/Q9NZH8

AA Sequence

MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anoctamin 7 (ANO7) (NM_001001891) Human Over-expression Lysate
LY424262 100 µg

Anoctamin 7 (ANO7) (NM_001001891) Human Over-expression Lysate

Sign In for Pricing
View Details
Trim41 Mouse Gene Knockout Kit (CRISPR)
KN518212 1 Kit

Trim41 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KCNB2 Mouse Monoclonal Antibody [Clone ID: N372B/1]
75-369 100 µL

KCNB2 Mouse Monoclonal Antibody [Clone ID: N372B/1]

Sign In for Pricing
View Details
Anti Human STARD5 Polyclonal
Y054602 100 µL

Anti Human STARD5 Polyclonal

Sign In for Pricing
View Details
BDNF (NM_001143808) Human Over-expression Lysate
LC428354 20 µg

BDNF (NM_001143808) Human Over-expression Lysate

Sign In for Pricing
View Details
Fos B (FOSB) (NM_001114171) Human Over-expression Lysate
LC426468 20 µg

Fos B (FOSB) (NM_001114171) Human Over-expression Lysate

Sign In for Pricing
View Details