Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STXBP4 Rabbit pAb (APR28089N)

Product Specifications

Background

Plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane. Inhibits the translocation of SLC2A4 from intracellular vesicles to the plasma membrane by STX4A binding and preventing the interaction between STX4A and VAMP2. Stimulation with insulin disrupts the interaction with STX4A, leading to increased levels of SLC2A4 at the plasma membrane. May also play a role in the regulation of insulin release by pancreatic beta cells after stimulation by glucose (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality STXBP4 Rabbit pAb (APR28089N) .

Synonyms

STXBP4; Synip

Gene ID

252983

UniProt

Q6ZWJ1

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa/61kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=252983

Uniprot URL

https://www.uniprot.org/uniprot/Q6ZWJ1

AA Sequence

EETRALRSRIHLAEAAQRQAHGMEMDYEEVIRLLEAKITELKAQLADYSDQNKESVQDLKKRIMVLDCQLRKSEMARKTFEASTEKLLHFVEAIQEVFSDNSTPLSNLSERRAVLASQTSLTPLGRNGRSIPATLALESKELVKSVRALLDMDCLPYGWEEAYTADGIKYFINHVTQTTSWIHPVMSVLNLSRSEENEEDCSRELPNQKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse C3a (Complement Component 3a) ELISA Kit
E-EL-M0337-01 24 Tests

Mouse C3a (Complement Component 3a) ELISA Kit

Sign In for Pricing
View Details
Mouse C3a (Complement Component 3a) ELISA Kit
E-EL-M0337-02 48 Tests

Mouse C3a (Complement Component 3a) ELISA Kit

Sign In for Pricing
View Details
Mouse C3a (Complement Component 3a) ELISA Kit
E-EL-M0337-03 96 Tests

Mouse C3a (Complement Component 3a) ELISA Kit

Sign In for Pricing
View Details
IL13 (NM_002188) Human Recombinant Protein
TP723715 10 µg

IL13 (NM_002188) Human Recombinant Protein

Sign In for Pricing
View Details
DOK3 Mouse Monoclonal Antibody [Clone ID: OTI3G9]
CF813140 100 µg

DOK3 Mouse Monoclonal Antibody [Clone ID: OTI3G9]

Sign In for Pricing
View Details
Mouse APOA1 (Apoliprotein A1) CLIA Kit
E-CL-M0096-01 24 Tests

Mouse APOA1 (Apoliprotein A1) CLIA Kit

Sign In for Pricing
View Details