Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STXBP4 Rabbit pAb (APR28089N)

Product Specifications

Background

Plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane. Inhibits the translocation of SLC2A4 from intracellular vesicles to the plasma membrane by STX4A binding and preventing the interaction between STX4A and VAMP2. Stimulation with insulin disrupts the interaction with STX4A, leading to increased levels of SLC2A4 at the plasma membrane. May also play a role in the regulation of insulin release by pancreatic beta cells after stimulation by glucose (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality STXBP4 Rabbit pAb (APR28089N) .

Synonyms

STXBP4; Synip

Gene ID

252983

UniProt

Q6ZWJ1

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa/61kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=252983

Uniprot URL

https://www.uniprot.org/uniprot/Q6ZWJ1

AA Sequence

EETRALRSRIHLAEAAQRQAHGMEMDYEEVIRLLEAKITELKAQLADYSDQNKESVQDLKKRIMVLDCQLRKSEMARKTFEASTEKLLHFVEAIQEVFSDNSTPLSNLSERRAVLASQTSLTPLGRNGRSIPATLALESKELVKSVRALLDMDCLPYGWEEAYTADGIKYFINHVTQTTSWIHPVMSVLNLSRSEENEEDCSRELPNQKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human B7H4 (VTCN1) activation kit by CRISPRa
GA112543 1 Kit

Human B7H4 (VTCN1) activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse GLP1R, C-His Tag
HA211109-01 20 µg

Mouse GLP1R, C-His Tag

Sign In for Pricing
View Details
Mouse GLP1R, C-His Tag
HA211109-02 50 µg

Mouse GLP1R, C-His Tag

Sign In for Pricing
View Details
Mouse GLP1R, C-His Tag
HA211109-03 100 µg

Mouse GLP1R, C-His Tag

Sign In for Pricing
View Details
(2-Acetamido-5-chlorophenyl)(phenyl)carbamic Acid tert-Butyl Ester
TRC-A150105-50MG 50 mg

(2-Acetamido-5-chlorophenyl)(phenyl)carbamic Acid tert-Butyl Ester

Sign In for Pricing
View Details
Acetic Acid-2-13C
TRC-A167641-1G 1 g

Acetic Acid-2-13C

Sign In for Pricing
View Details