Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LLGL2 Rabbit pAb (APR28087N)

Product Specifications

Background

The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the protein's ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC) . In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LLGL2 Rabbit pAb (APR28087N) .

Synonyms

LLGL2; HGL; Hugl-2; LGL2

Gene ID

217325

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 114kDa Observed MW: 113kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=217325

AA Sequence

RQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRSRVSSHKRRPGGPTGEAQAQAVNIKAERTGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLRDSSRHCPSLWAGTNGGTVYAFSLRVPPAERRTDEPVRAEQAKEIQLMHRAPVVGILVLDGHNVPLPEPLEVAHDLSKSPDMQGSHQLLVVSEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPAS1 (Neuronal PAS Domain-containing Protein 1, Neuronal PAS Domain Protein 1
487074 100 µL

NPAS1 (Neuronal PAS Domain-containing Protein 1, Neuronal PAS Domain Protein 1

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF640R conjugate, 0.1mg/mL
BNC400018-100 1x 100 µL

Human Kappa Light Chain (L1C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B4GALT2 Protein Vector (Human) (pPB-His-MBP)
PV326006 500 ng

B4GALT2 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
MYCL Antibody
16-536 100 µL

MYCL Antibody

Sign In for Pricing
View Details
CXorf36 Antibody - N-terminal region
ARP68244_P050-25UL 25 µL

CXorf36 Antibody - N-terminal region

Sign In for Pricing
View Details
IL36G Antibody
C44239-01 50 μL

IL36G Antibody

Sign In for Pricing
View Details