Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCP2 Rabbit pAb (APR28086N)

Product Specifications

Background

The protein encoded by this gene is a key component of an mRNA-decapping complex required for degradation of mRNAs, both in normal mRNA turnover, and in nonsense-mediated mRNA decay (NMD) . It removes the 7-methyl guanine cap structure from mRNA, prior to its degradation from the 5' end. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DCP2 Rabbit pAb (APR28086N) .

Synonyms

DCP2; NUDT20

Gene ID

167227

UniProt

Q8IU60

Cellular Locus

Cytoplasm, Nucleus, P-body

Applications

IF (293T)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 44kDa/48kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=167227

Uniprot URL

https://www.uniprot.org/uniprot/Q8IU60

AA Sequence

METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose XAA-Pro Aminopeptidase 2 (XPNPEP2) ELISA Kit
MBS9904161 Inquire

Goose XAA-Pro Aminopeptidase 2 (XPNPEP2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Photosystem I reaction center subunit III, chloroplastic (PSAF)
orb2931474-01 20 µg

Recombinant Arabidopsis thaliana Photosystem I reaction center subunit III, chloroplastic (PSAF)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Photosystem I reaction center subunit III, chloroplastic (PSAF)
orb2931474-02 100 µg

Recombinant Arabidopsis thaliana Photosystem I reaction center subunit III, chloroplastic (PSAF)

Sign In for Pricing
View Details
Lentiviral human ARL4D shRNA (UAS) - Lentiviral human ARL4D shRNA (UAS, RFP) (25)
GTR15127367 1 Vial

Lentiviral human ARL4D shRNA (UAS) - Lentiviral human ARL4D shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
ING2 Rabbit Polyclonal Antibody
TA349354 100 µL

ING2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COTL1 (CLP, Coactosin-like Protein)
145439 100 µg

COTL1 (CLP, Coactosin-like Protein)

Sign In for Pricing
View Details